HORDB

ID: hor006484
Uniprot ID: Q9PUR1
Protein name: Glucagon-like peptide 2-I
Gene name: gcg1
Organism: Petromyzon marinus (Sea lamprey)
Family: Glucagon family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Petromyzon (genus), Petromyzontidae (family), Petromyzontiformes (order), Hyperoartia (class), Cyclostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007165 signal transduction; GO:0050896 response to stimulus
GO CC: GO:0005576 extracellular region

Sequence: HAEDVNALLDRTMAKTFIEWLEKQNSNDQTD
Length: 31
Propeptide: MSDPGFLAAPVLLLLLVSLASASLEQAASRDDDSAERPLSKRHSEGTFTSDYSKYLENKQAKDFVRWLMNAKRGGSELQRRHADGTFTNDMTSYLDAKAARDFVSWLARSDKSRRDGGDHLAENSEDKRHAEDVNALLDRTMAKTFIEWLEKQNSNDQTD
Signal peptide: MSDPGFLAAPVLLLLLVSLASA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006484_AF2.pdb

hor006484_ESM.pdb

Mass:	416926	Formula:	C155H242N44O55S
Absent amino acids:	CGPY	Common amino acids:	D
pI:	4.17	Basic residues:	4
Polar residues:	7	Hydrophobic residues:	10
Hydrophobicity:	-100.32	Boman Index:	-9129
Half-Life:	3.5 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	69.35
Instability Index:	4207.42	Extinction Coefficient cystines:	5500
Absorbance 280nm:	183.33

PubMed ID: 10555286
Title: Lamprey proglucagon and the origin of glucagon-like peptides.
PubMed ID: 8405897
Title: Primary structures of glucagon and glucagon-like peptide isolated from the intestine of the parasitic phase lamprey Petromyzon marinus.